PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S13092.20
Common NameJCGZ_21574, LOC105650157
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 361aa    MW: 41447.3 Da    PI: 8.5015
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S13092.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-3182135255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Jcr4S13092.20  82 PRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 135
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-3078136IPR009057Homeodomain-like
PROSITE profilePS5129411.62878138IPR017930Myb domain
SuperFamilySSF466892.15E-1480136IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2282137IPR006447Myb domain, plants
PfamPF002498.7E-983134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MLDHQEKSIG SGGEEQAENT SLASSSQKCS SFDLNEEASC SEEDEDEKIT EEGSSSANNN  60
NSSSERNERK STVRQYVRSK MPRLRWTPDL HLSFVHAVER LGGQERATPK LVLQLMNVRG  120
LSIAHVKSHL QMYRSKKLDE AGQVLSQAYR SMQRRDNTNT GMLPPQKQFR MENGGFVFAR  180
NSVLPRITAF GHNPFPLHSS FSQRPFNFRT NFSSHQHWSF DQNEVRRQIN SMTSKDHEQG  240
LDATMRIGPL RPSRFLEEKR WPPMEMVKNR WKIMENPNEV TCNTEPEAHP RSAGSTLFAS  300
NDSISHFNCF KATFEPPFRL ELNQEKVLPD LQLRLSQRVE LDENKSNCRS KQEISTKLSL  360
S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012092425.10.0PREDICTED: putative two-component response regulator ARR19
TrEMBLA0A067JEB20.0A0A067JEB2_JATCU; Uncharacterized protein
STRINGGLYMA05G29161.14e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-37G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]